PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG442300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 392aa    MW: 41397.1 Da    PI: 7.604
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG442300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.3e-25120164145
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Pavir.1NG442300.1.p 120 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 164
                          79****************************************997 PP

2QLQ60.26e-215994237
                  QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                         +FT+aQ ++L++Q+l+yKyL+a++PvPp+L+++i++
  Pavir.1NG442300.1.p 59 SFTPAQYEELEQQALIYKYLVAGVPVPPDLVLPIRR 94
                         7*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-115894IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.5E-155993IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.0015994IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486120164IPR014977WRC domain
PfamPF088794.0E-21121163IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MAMPYASLSP AGADHRSSTA TASLLPFCRA TPLSVSPASG GGPAEDAQVG ARWAARPVSF  60
TPAQYEELEQ QALIYKYLVA GVPVPPDLVL PIRRGLDALA TRFYGHPTLG YGSYFGKKLD  120
PEPGRCRRTD GKKWRCSKEA APDSKYCERH MHRGRNRSRK PVETQLVPPS QPPATAAASP  180
AAPLAAAANG SSFQNHSLYP AIAGSTGGGG GASNMSSPFS SPLGSSPLHM DNAASYAALG  240
GGTAKDLRYN AYGIRSLADE HNQLIAEAID SSMENQWRLP PSQNSAFPLS SYPQLGALSD  300
LGPNGVSSLS KMDRQPLSFL GHDFGGINSG KQENQTLRPF FDEWPKARDS WPGLSDDNTN  360
LASFPATQLS ISIPMASSDF SVASSQSPND D*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5158400.0EF515840.1 Zea mays putative growth-regulating factor 1 (GRF1) mRNA, complete cds.
GenBankKJ7279720.0KJ727972.1 Zea mays clone pUT6086 GRF transcription factor (GRF6) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953585.10.0PREDICTED: growth-regulating factor 4-like
SwissprotQ6ZIK50.0GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLK3YT540.0K3YT54_SETIT; Uncharacterized protein
STRINGSi017449m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-49growth-regulating factor 5